PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10022720
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family bZIP
Protein Properties Length: 371aa    MW: 39960.1 Da    PI: 5.0925
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10022720genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_143.47.3e-14276328557
                  CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkeva 57 
                  +r+rr++kNRe+A rsR+RK+a++ eLe +  +L++eN++Lk+ l e++ + +
  Lus10022720 276 RRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENRQLKQALAEMERKRK 328
                  79****************************************76666655544 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1702.3E-14269328No hitNo description
SMARTSM003388.5E-13272333IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.634274326IPR004827Basic-leucine zipper domain
SuperFamilySSF579592.31E-10276326No hitNo description
CDDcd147071.43E-23276330No hitNo description
PfamPF001701.4E-11276329IPR004827Basic-leucine zipper domain
PROSITE patternPS000360279294IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 371 aa     Download sequence    Send to blast
MGDQEMNSNG EVESALQLDN QCNNNKSNNP FPSLGRQSSI YSLTLDEFQH TLCGEGGKNF  60
GSMKMDEFLN SIWTAEENQH PNPAAGASVS HAPLPGGGSN GCGGSGDHPS GKGIAKQPSL  120
PRQGSLTLPE KLCRKTVDEV WSEIHSGNRK FGGGQRKSGD NNEANSNSNS QVNVRNNSES  180
TPRQPTFGEM TLEDFLIKAG VVREQQCGGG GVGYTPPPPP PSQSLPVVGP VSPVSSDGMA  240
AAANIDVVGN HYGMDMSGLR GRKRIIDGPV EKVVERRQRR MIKNRESAAR SRARKQAYTV  300
ELEAELNQLK EENRQLKQAL AEMERKRKQQ LSCGAVPRGN EIEGTEQGAG EADADEEEFE  360
LSIMIQDEDT *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012066490.11e-117PREDICTED: protein ABSCISIC ACID-INSENSITIVE 5
SwissprotQ9SJN01e-103ABI5_ARATH; Protein ABSCISIC ACID-INSENSITIVE 5
TrEMBLA0A067L6C21e-117A0A067L6C2_JATCU; Uncharacterized protein
STRINGBra017251.1-P1e-106(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20923374
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G36270.13e-44bZIP family protein